PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00035768-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family NF-YB
Protein Properties Length: 151aa    MW: 17035.2 Da    PI: 4.347
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00035768-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB75.11e-231199391
             NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
                      ++d  lP a + +i+k++lP++ ++++da++++ ec +efi +++se+++ c re+++ti+++ +l al  lGf dy+e++ +  +++r
  PSME_00035768-RA 11 KDDVSLPKATMFKIIKEMLPQDVRVARDAQDLLVECCVEFINLISSESNEVCGREEKRTIAPEHVLRALEVLGFGDYIEEVYAAYEQHR 99
                      67889**************************************************************************9977666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.8E-398142IPR009072Histone-fold
SuperFamilySSF471133.11E-3512140IPR009072Histone-fold
PfamPF008085.7E-201579IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MEPMDIVGKS KDDVSLPKAT MFKIIKEMLP QDVRVARDAQ DLLVECCVEF INLISSESNE  60
VCGREEKRTI APEHVLRALE VLGFGDYIEE VYAAYEQHRL ETLDSPKSGR WASGAEMTEE  120
EALAEQQRMF AEARARMNNG NANPPRQSDS D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B5e-371213412133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6770040.0EF677004.1 Picea sitchensis clone WS02759_P15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011622414.11e-100PREDICTED: protein Dr1 homolog
RefseqXP_006841904.11e-100PREDICTED: protein Dr1 homolog
SwissprotP495926e-83NC2B_ARATH; Protein Dr1 homolog
TrEMBLB8LMI41e-108B8LMI4_PICSI; Putative uncharacterized protein
STRINGPGSC0003DMT4000104361e-89(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.46e-86nuclear factor Y, subunit B13